ATP6_STAA9 ATP synthase subunit a 242 MDHKSPLVSWNLFGFDIVFNLSSILMILVTAFLVFLLAIICTRNLKKRPTGKQNFVEWIFDFVRGIIEGNMAWKKGGQFHFLAVTLILYIFIANMLGLPFSIVTKDHTLWWKSPTADATVTLTLSTTIILLTHFYGIKMRGTKQYLKGYVQPFWPLAIINVFEEFTSTLTLGLRLYGNIFAGEILLTLLAGLFFNEPAWGWIISIPGLIVWQAFSIFVGTIQAYIFIMLSMVYMSHKVADEH F-ATPase subunit 6 SaurJH9_2145 atpB ATP synthase F0 sector subunit a Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane (By similarity).